PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g083180.1
Common NameMTR_1g083180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 187aa    MW: 21505.9 Da    PI: 7.9985
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g083180.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1363105447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      W +e + l++++++++G+g W +Ia+++g ++t  q+ s+ qk+
  Medtr1g083180.1  63 WDEEQHRLFLEGFEKYGKGKWIKIAQHVG-TKTTTQVASHAQKH 105
                      *****************************.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.19855110IPR017930Myb domain
SuperFamilySSF466893.29E-1656111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-858106IPR009057Homeodomain-like
SMARTSM007173.0E-759108IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.8E-1259108IPR006447Myb domain, plants
PfamPF002491.1E-1163105IPR001005SANT/Myb domain
CDDcd001672.59E-963106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MYHYSSNQQN YQNTDDNGLA FIDADHVKFP THSDGFISKE NVSADENKVP PLVNKINKGQ  60
YHWDEEQHRL FLEGFEKYGK GKWIKIAQHV GTKTTTQVAS HAQKHFIRIK ESAKLSKIRK  120
RRSIFYTTTT TNNSWDGNFH PLLYRDNIPS PPSPPPNIET ESIVEQILQQ LQQAQEALWN  180
DNVILS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1612410.0AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591133.11e-138myb-like DNA-binding domain, shaqkyf class protein
TrEMBLG7I8N41e-138G7I8N4_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2055925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-16MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]